"event" : "MessagesWidgetEditCommentForm", "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ }, ] "action" : "pulsate" "context" : "", { "disableKudosForAnonUser" : "false", { "componentId" : "kudos.widget.button", { { "event" : "MessagesWidgetEditAction", "context" : "envParam:quiltName", window.NREUM||(NREUM={});NREUM.info={"errorBeacon":"bam-cell.nr-data.net","licenseKey":"90ec53e80f","agent":"","beacon":"bam-cell.nr-data.net","applicationTime":1000,"applicationID":"309530949","transactionName":"M1BRYEAEWBVYURYLWAoaZFFQSmIHSVcRFkUdZVJTV19wCUtHDzZYFFxQZFMCUw==","queueTime":0,"atts":"HxdGFggeFA1afA0GUjBMQ1EQXxQAVkAXDxoGWlJGVkcaRF9AAw9SLVERDgNXAFIJA1VbB1wHChgQDlUzSlcQK1NGDx4FHkddBWlTBQd5BVhWFghHcAlLRw82WBRcUGRTAlNEFRAJAXoLV1pYV0cMRF9TDhFSRhkRX1EnWRIbCEAEVghGVhYeR10FbUpAWBVWVwVVVAQCABRQUVoFSQFQDAJIVwcMBk9bAQIAUAcLVgRVDwFAThUPVn1bVgB\/AhsIQDFDC0dGWlUWWwNVVhcMUAFbelpGAEQIXEY2NGMBWVZSXQsUShtZATBSF0FlBmMQUxRAEFhAZCF5dndmRV8CGXQwLXpEWFZHQQRRA0oSNSpyNnATQF0VXwUXWwZfCER5enl7MRZZG08f"}, \n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "", "dialogContentCssClass" : "lia-panel-dialog-content", }, "context" : "envParam:quiltName,product,contextId,contextUrl", ] ], "quiltName" : "ForumMessage", "initiatorDataMatcher" : "data-lia-kudos-id" Bist du sicher, dass du fortfahren möchtest? "action" : "rerender" "disableKudosForAnonUser" : "false", "event" : "removeThreadUserEmailSubscription", ] { "event" : "addMessageUserEmailSubscription", }, ] "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { // enable redirect to login page when "logmein" is typed into the void =) ] }, ] { { } { "context" : "lia-deleted-state", "context" : "lia-deleted-state", { "action" : "rerender" "context" : "envParam:quiltName,message", "action" : "rerender" "action" : "rerender" } else { "context" : "lia-deleted-state", "disableLinks" : "false", "actions" : [ ] "initiatorBinding" : true, LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "event" : "editProductMessage", ] { }, { }, ', 'ajax'); "actions" : [ }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_48","feedbackSelector":".InfoMessage"}); } ;(function($) { o.innerHTML = "Page must be an integer number. { { }); } "action" : "rerender" Damit erhalte ich jedoch selbst keine Antwort via E-Mail noch kann ich den E-Mail Verlauf verwenden um diesen im Nachgang an die relevanten Stellen weiterzuleiten. "action" : "rerender" { }, "truncateBody" : "true", }); LITHIUM.AjaxSupport.fromForm('#form_7', 'GiveRating', '#ajaxfeedback_7', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { }, 28,926 were here. "message" : "2435249", "actions" : [ } "message" : "2436988", "event" : "ProductMessageEdit", { ] }); "context" : "", } "action" : "rerender" "actions" : [ { "context" : "", "action" : "rerender" "actions" : [ $(document).ready(function(){ "event" : "ProductMessageEdit", $('#vodafone-community-header .lia-search-toggle').click(function() { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", }, "displaySubject" : "true", Execute whatever should happen when entering the right sequence } { } "kudosLinksDisabled" : "false", ] "context" : "lia-deleted-state", { "event" : "removeThreadUserEmailSubscription", }, "includeRepliesModerationState" : "false", "disableLinks" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", "event" : "MessagesWidgetEditAnswerForm", { ] { ] { ] "actions" : [ } "context" : "envParam:quiltName", }, } "initiatorDataMatcher" : "data-lia-message-uid" } ], ] "context" : "", "context" : "", "actions" : [ "context" : "", ', 'ajax'); }, } }, "quiltName" : "ForumMessage", }, "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "rerender" "showCountOnly" : "false", "event" : "markAsSpamWithoutRedirect", { LITHIUM.Cache.CustomEvent.set([{"elementId":"link_5","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2432493}},{"elementId":"link_9","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2432546}},{"elementId":"link_13","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2432564}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2433932}},{"elementId":"link_21","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2433958}},{"elementId":"link_25","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2434714}},{"elementId":"link_29","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2435249}},{"elementId":"link_33","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2436414}},{"elementId":"link_37","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2436988}},{"elementId":"link_41","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2439128}},{"elementId":"link_44","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492762}},{"elementId":"link_45","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2492188}},{"elementId":"link_46","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493193}},{"elementId":"link_47","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2493135}},{"elementId":"link_48","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2495862}},{"elementId":"link_50","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565828}},{"elementId":"link_51","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565724}},{"elementId":"link_52","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565665}},{"elementId":"link_54","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565632}},{"elementId":"link_55","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565564}},{"elementId":"link_56","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565485}},{"elementId":"link_57","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565414}},{"elementId":"link_58","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565384}},{"elementId":"link_59","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565375}},{"elementId":"link_60","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":2565369}}]); LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "parameters" : { ] { .attr('aria-expanded','false') "event" : "MessagesWidgetAnswerForm", } { })(LITHIUM.jQuery); // Pull in global jQuery reference "actions" : [ if ( Number(val) < 1 ) ;(function($) { "actions" : [ { "showCountOnly" : "false", { { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" 08001721212. ] "event" : "MessagesWidgetCommentForm", }, }); } "useSimpleView" : "false", }, "quiltName" : "ForumMessage", }); }, "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_41","feedbackSelector":".InfoMessage"}); "action" : "rerender" "actions" : [ ] "useCountToKudo" : "false", "event" : "ProductAnswerComment", "event" : "MessagesWidgetMessageEdit", Execute whatever should happen when entering the right sequence "action" : "rerender" { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/341512","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ieUeE3i7aoqeeX08hYuYijp60tuZaLMsM3iBLjhcXCo. ] "initiatorDataMatcher" : "data-lia-message-uid" "event" : "MessagesWidgetCommentForm", ] "parameters" : { "action" : "rerender" { "context" : "", }); }, "disableLinks" : "false", } { { { "action" : "rerender" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); { })(LITHIUM.jQuery); // Pull in global jQuery reference { "event" : "ProductMessageEdit", { } { "action" : "rerender" }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_0","feedbackSelector":".InfoMessage"}); }, ] "actions" : [ count = 0; "revokeMode" : "true", o.innerHTML = ""; "showCountOnly" : "false", "eventActions" : [ { "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "disableKudosForAnonUser" : "false", ', 'ajax'); "event" : "MessagesWidgetCommentForm", } } Execute whatever should happen when entering the right sequence } "actions" : [ { }, { "actions" : [ }, { }, "kudosLinksDisabled" : "false", "parameters" : { "context" : "", "action" : "rerender" "event" : "markAsSpamWithoutRedirect", "action" : "rerender" }, ] }, ] }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); } "action" : "rerender" { "event" : "MessagesWidgetCommentForm", { "context" : "lia-deleted-state", }, clearWarning(pagerId); "event" : "MessagesWidgetAnswerForm", { { }, if ( key == neededkeys[0] ) { { return false; "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", } { { watching = true; } { "event" : "ProductMessageEdit", "event" : "ProductAnswerComment", "actions" : [ } "initiatorBinding" : true, ] "action" : "rerender" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_8","componentSelector":"#lineardisplaymessageviewwrapper_8","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2439128,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. { "useTruncatedSubject" : "true", }, LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2433958 .lia-rating-control-passive', '#form_3'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_44","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, "disableKudosForAnonUser" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", return; "context" : "envParam:entity", "useTruncatedSubject" : "true", }, "initiatorBinding" : true, "selector" : "#kudosButtonV2_5", { }, }); "action" : "rerender" "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ;(function($) { "initiatorDataMatcher" : "data-lia-kudos-id" { { ] { } "truncateBody" : "true", }, ] "action" : "rerender" { "action" : "rerender" { }, Anbei wie gewünscht: aufgrund eines Forumeintrages wissen wir leider nicht sofort, wer Du bist. LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ }, ] ], "useSubjectIcons" : "true", if(1 < 2){ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_46","feedbackSelector":".InfoMessage"}); "action" : "rerender" { } "event" : "MessagesWidgetEditCommentForm", } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "disallowZeroCount" : "false", "event" : "ProductMessageEdit", { } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_0","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/341512","ajaxErrorEventName":"LITHIUM:ajaxError","token":"iaTI0pjgdfhYqTufXpNPO70fCRcW_-Ft7f1yPtIvID0. watching = true; Wenn die Vodafone Hotline nicht erreichbar ist, gibt es folgende weiteren Möglichkeiten um die Störung zu melden: LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, 'ACN5jvb-n2QV6afdnHVuFctoHt7BDgP17745aDpQS6I. } ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); ","loaderSelector":"#lineardisplaymessageviewwrapper_5 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } "action" : "rerender" { { } { { { }, }, ] }, { { { "actions" : [ /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); //$('#community-menu-toggle').removeClass('active') "; LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { "actions" : [ }, { "action" : "rerender" $(this).next().toggle(); ] "actions" : [ }); { "}); LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "pulsate" { "context" : "envParam:quiltName,message", "disallowZeroCount" : "false", })(LITHIUM.jQuery); { } { "event" : "ProductAnswerComment", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/StorungsmeldungenInternetTVTelefon/thread-id/341512","ajaxErrorEventName":"LITHIUM:ajaxError","token":"pmosML7u5SYvDHR1_gVVHiEPP_LrOAZ9UnCe6lvJAkE. { }, LITHIUM.AjaxSupport.fromForm('#form_6', 'GiveRating', '#ajaxfeedback_6', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); "message" : "2439128", function doChecks(pagerId, val) { "action" : "pulsate" "actions" : [ { }, { ;(function($) { "componentId" : "kudos.widget.button", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ] } ], }, ] "displayStyle" : "horizontal", { { { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_31","feedbackSelector":".InfoMessage"}); { setWarning(pagerId); } "action" : "rerender" ] Prüf bitte zuerst, ob es an Deinem Anschluss eine Netz-Störung gibt. "event" : "MessagesWidgetEditAnswerForm", } "action" : "rerender" function doChecks(pagerId, val) { "event" : "ProductMessageEdit", "event" : "QuickReply", } { }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "context" : "", { ] } "disableLinks" : "false", "event" : "unapproveMessage", if ( Number(val) < 1 ) "componentId" : "forums.widget.message-view", Die Störung ist mittlerweile behoben. ] { { "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "linkDisabled" : "false" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); "action" : "rerender" "action" : "rerender" }, "action" : "rerender" $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { ] { "; ] ] "actions" : [ }, ] }, } else { }, $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "triggerEvent" : "click", "event" : "ProductAnswerComment", LITHIUM.InputEditForm("form_8", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. }, "context" : "", "actions" : [